P2X4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192239

Catalog No. NBP192239

Description

P2X4 Polyclonal specifically detects P2X4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: P2X4
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
• Gene Alias: ATP receptor, ATP-gated cation channel protein, P2X purinoceptor 4, P2X4P2X receptor, subunit 4, P2X4R, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 4, purinoceptor P2X4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: P2RX4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YCMKKRLYYREKKYKYVEDYEQGLASELDQ
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5025
• Target Species: Human
• Isotype: IgG

For Research Use Only