P2X5/P2RX5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25641925UL

Catalog No. NB403702

Description

P2X5/P2RX5 Polyclonal specifically detects P2X5/P2RX5 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: P2X5/P2RX5
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: ATP receptor, ATP receptor subunit, ionotropic ATP receptor P2X5, LRH-1, MGC47755, P2X purinoceptor 5, P2X5lymphoid-restricted histocompatibility antigen-1, P2X5R, Purinergic receptor, purinergic receptor P2X ligand gated ion channel 5, purinergic receptor P2X, ligand-gated ion channel, 5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: P2RX5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKE
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5026
• Target Species: Human
• Form: Purified

For Research Use Only