P2Y10/P2RY10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256283

Catalog No. NBP256283

Description

P2Y10/P2RY10 Polyclonal specifically detects P2Y10/P2RY10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: P2Y10/P2RY10
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: G-protein coupled purinergic receptor P2Y10, P2Y purinoceptor 10, P2Y10P2Y-like receptor, purinergic receptor P2Y, G-protein coupled, 10, putative P2Y purinoceptor 10
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: P2RY10
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cytokine Research, GPCR, Plasma Membrane Markers
• Gene ID (Entrez): 27334
• Target Species: Human
• Isotype: IgG

For Research Use Only