Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
P2Y12/P2RY12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 5 publications
Supplier: Novus Biologicals NBP233870
Description
P2Y12/P2RY12 Polyclonal specifically detects P2Y12/P2RY12 in Human, Canine, Feline samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
| P2Y12/P2RY12 | |
| Polyclonal | |
| Western Blot - reported in scientific literature (PMID:31968618)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence -validated from a verified customer review, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen -validated from a verified customer review | |
| Q9H244 | |
| P2RY12 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | |
| 0.1 mL | |
| GPCR | |
| 64805 | |
| Human, Feline | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ADPG-R, Gi-coupled ADP receptor HORK3, HORK3P2Y12 platelet ADP receptor, P2T(AC), P2Y purinoceptor 12, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12ADP-glucose receptor, purinergic receptor P2RY12, purinergic receptor P2Y, G-protein coupled, 12, putative G-protein coupled receptor, SP1999G-protein coupled receptor SP1999 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human P2Y12/P2RY12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction