Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. P2Y12/P2RY12 Antibody, Novus Biologicals™

P2Y12/P2RY12 Antibody, Novus Biologicals™
SDP

Catalog No. NBP233870 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP233870 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP233870 Supplier Novus Biologicals Supplier No. NBP233870
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 5 publications

P2Y12/P2RY12 Polyclonal specifically detects P2Y12/P2RY12 in Human, Canine, Feline samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

Antigen P2Y12/P2RY12
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot - reported in scientific literature (PMID:31968618)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence -validated from a verified customer review, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen -validated from a verified customer review
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9H244
Gene Alias ADPG-R, Gi-coupled ADP receptor HORK3, HORK3P2Y12 platelet ADP receptor, P2T(AC), P2Y purinoceptor 12, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12ADP-glucose receptor, purinergic receptor P2RY12, purinergic receptor P2Y, G-protein coupled, 12, putative G-protein coupled receptor, SP1999G-protein coupled receptor SP1999
Gene Symbols P2RY12
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline GPCR
Primary or Secondary Primary
Gene ID (Entrez) 64805
Test Specificity Specificity of human P2Y12/P2RY12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Feline
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.