P311 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184315

Catalog No. NBP184315

Description

P311 Polyclonal antibody specifically detects P311 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: P311
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: chromosome 5 open reading frame 13, neuronal protein 3.1, P311PTZ17D4S114, PRO1873, Protein p311
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human P311 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NREP
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 9315
• Target Species: Human
• Isotype: IgG

For Research Use Only