Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
p38 beta/MAPK11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | p38 beta/MAPK11 |
---|---|
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
p38 beta/MAPK11 Polyclonal antibody specifically detects p38 beta/MAPK11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
p38 beta/MAPK11 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Breast Cancer, Cancer, Protein Kinase | |
PBS (pH 7.2), 40% Glycerol | |
5600 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
EC 2.7.11, EC 2.7.11.24, MAP kinase 11, MAP kinase p38 beta, MAPK 11, mitogen-activated protein kinase 11, Mitogen-activated protein kinase p38 beta, mitogen-activated protein kinase p38-2, p38b, p38Beta, P38BETA2, PRKM11, SAPK2B, SAPK2p38-2P38B, Stress-activated protein kinase 2, stress-activated protein kinase-2, stress-activated protein kinase-2b | |
This antibody was developed against a recombinant protein corresponding to amino acids: DYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title