Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. p40 Antibody, Novus Biologicals™

p40 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15700320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15700320 20 μL
NBP157003 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15700320 Supplier Novus Biologicals Supplier No. NBP15700320UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

p40 Polyclonal specifically detects p40 in Human samples. It is validated for Western Blot.

Specifications

Antigen p40 (p63 delta)
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q7Z6M1
Gene Alias 40 kDa Rab9 effector protein, bA65N13.1, p40, p40-p63 delta, Rab9 effector p40, Rab9 effector protein with kelch motifs, RAB9P40DKFZp686P1077, RABEPK
Gene Symbols RABEPK
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RABEPK (Rab9 effector protein with kelch motifs) The peptide sequence was selected from the N terminal of RABEPK. Peptide sequence MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10244
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.