Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
p40 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15700320UL
Description
p40 Polyclonal specifically detects p40 in Human samples. It is validated for Western Blot.Specifications
p40 (p63 delta) | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q7Z6M1 | |
RABEPK | |
Synthetic peptides corresponding to RABEPK (Rab9 effector protein with kelch motifs) The peptide sequence was selected from the N terminal of RABEPK. Peptide sequence MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
40 kDa Rab9 effector protein, bA65N13.1, p40, p40-p63 delta, Rab9 effector p40, Rab9 effector protein with kelch motifs, RAB9P40DKFZp686P1077, RABEPK | |
Rabbit | |
Affinity Purified | |
RUO | |
10244 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction