p53 Antibody (CL2199), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NBP234495	Novus Biologicals NBP234495	0.1 mL

Description

p53 Monoclonal specifically detects p53 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated, PCR.

Specifications

• Antigen: p53
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Mouse
• Research Discipline: Apoptosis, Cancer, Cell Cycle and Replication, Cellular Markers, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, HIF Target Genes, Hypoxia, Neuroscience, Neurotransmission, p53 Pathway, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors
• Gene Accession No.: P04637
• Gene ID (Entrez): 7157
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Clone: CL2199
• Classification: Monoclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53
• Gene Symbols: TP53
• Isotype: IgG1
• Purification Method: Protein A purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only