Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
p53R2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | p53R2 |
---|---|
Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
p53R2 Polyclonal specifically detects p53R2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
p53R2 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q7LG56 | |
50484 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Apoptosis, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Hypoxia, Modulation of DNA Pools | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
EC 1.17.4.1, MGC102856, MGC42116, MTDPS8A, MTDPS8B, p53-inducible ribonucleotide reductase small subunit 2 homolog, p53-inducible ribonucleotide reductase small subunit 2-like protein, p53R2, P53R2DKFZp686M05248, PEOA5, ribonucleoside-diphosphate reductase subunit M2 B, ribonucleotide reductase M2 B (TP53 inducible), TP53-inducible ribonucleotide reductase M2 B | |
RRM2B | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title