Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PABPC1L2A Antibody, Novus Biologicals™

PABPC1L2A Antibody, Novus Biologicals™
SDP

Catalog No. NB395298 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395298 25 μL
NBP254693 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB395298 Supplier Novus Biologicals Supplier No. NBP25469325UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PABPC1L2A Polyclonal specifically detects PABPC1L2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PABPC1L2A
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias MGC168104, PABPC1L2, PABPC1L2B, poly(A) binding protein, cytoplasmic 1-like 2A, polyadenylate-binding protein 1-like 2, RBM32A, RBM32B, RNA binding motif protein 32A, RNA-binding motif protein 32, RNA-binding protein 32
Gene Symbols PABPC1L2A
Host Species Rabbit
Immunogen This antibody was developed against a Recombinant Protein corresponding to amino acids:KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 340529
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.