Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PABPC1L2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25469325UL
Description
PABPC1L2A Polyclonal specifically detects PABPC1L2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PABPC1L2A | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:50 - 1:200 | |
MGC168104, PABPC1L2, PABPC1L2B, poly(A) binding protein, cytoplasmic 1-like 2A, polyadenylate-binding protein 1-like 2, RBM32A, RBM32B, RNA binding motif protein 32A, RNA-binding motif protein 32, RNA-binding protein 32 | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
340529 | |
Human | |
IgG |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PABPC1L2A | |
This antibody was developed against a Recombinant Protein corresponding to amino acids:KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction