PAC1R Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP247340

Catalog No. NBP247340

Description

PAC1R Polyclonal specifically detects PAC1R in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PAC1R
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: adenylate cyclase activating polypeptide 1 (pituitary) receptor type 1, adenylate cyclase activating polypeptide 1 (pituitary) receptor type I, PACAP type I receptor, PACAP-R1, PACAP-R-1, PACAPRI, PACAPRPAC1, pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop, pituitary adenylate cyclase-activating polypeptide type I receptor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ADCYAP1R1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWD
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cell Cycle and Replication, GPCR, Neuroscience, Neurotransmission, Signal Transduction
• Gene ID (Entrez): 117
• Target Species: Human
• Isotype: IgG

For Research Use Only