PACSIN2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP213723

Catalog No. NBP213723

Description

PACSIN2 Polyclonal specifically detects PACSIN2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PACSIN2
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: cytoplasmic phosphoprotein PACSIN2, protein kinase C and casein kinase substrate in neurons 2, protein kinase C and casein kinase substrate in neurons protein 2, SDPII, syndapin II
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11252
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PACSIN2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only