Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAGE4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310548100UL
Description
PAGE4 Polyclonal specifically detects PAGE4 in Human samples. It is validated for Western Blot.Specifications
PAGE4 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
CT16.7, G antigen family C member 1, G antigen, family C, 1, GAGEC1GAGE-9, JM-27, P antigen family, member 4 (prostate associated), PAGE-1, PAGE-4FLJ35184, Prostate-associated gene 4 protein, prostate-associated gene protein 4 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PAGE4 (XP_005278137). Peptide sequence DGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDC | |
100 μg | |
Cancer, Neuroscience, Vision | |
9506 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction