Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAK1 interacting protein 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP26861525UL
Description
PAK1 interacting protein 1 Polyclonal antibody specifically detects PAK1 interacting protein 1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
PAK1 interacting protein 1 | |
Polyclonal | |
Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
bA421M1.5, FLJ20624, hPIP1WD repeat-containing protein 84, MAK11, p21-activated protein kinase-interacting protein 1, PAK1 interacting protein 1, PIP1PAK/PLC-interacting protein 1, RP11-421M1.5, WDR84PAK1-interacting protein 1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: GTITNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMISFEIPEHHVIVSASSDGFIKMWK | |
25 μL | |
Primary | |
Human | |
Purified |
Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol | |
Rabbit | |
Protein A purified | |
RUO | |
55003 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction