Palladin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258731

Catalog No. NBP258731

Description

Palladin Polyclonal specifically detects Palladin in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Palladin
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CGI151, CGI-151, FLJ22190, FLJ38193, KIAA0992FLJ39139, MYN, myoneurin, palladin, palladin, cytoskeletal associated protein, PNCA1, Sarcoma antigen NY-SAR-77, SIH002FLJ61376
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PALLD
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQMQFNAAERETNGVHPSRGVNGLINGKANSNKSLPTP
• Quantity: 100 μL
• Research Discipline: Cellular Markers, Cytoskeleton Markers, Signal Transduction
• Gene ID (Entrez): 23022
• Target Species: Human
• Isotype: IgG

For Research Use Only