Pallidin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18735725UL

Catalog No. NB431466

Description

Pallidin Polyclonal specifically detects Pallidin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Pallidin
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: PALLID, pallid (mouse) homolog, pallidin, Pallid protein homolog, pallidin, pallidin homolog (mouse), PAsyntaxin 13 binding protein 1, Syntaxin 13-interacting protein, syntaxin 13-interacting protein pallid
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: BLOC1S6
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM
• Quantity: 25 μL
• Research Discipline: Membrane Trafficking and Chaperones, Neuronal Cell Markers, Neuroscience, Signal Transduction
• Gene ID (Entrez): 26258
• Target Species: Human
• Isotype: IgG

For Research Use Only