Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAMCI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PAMCI |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PAMCI Polyclonal specifically detects PAMCI in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PAMCI | |
Polyclonal | |
Rabbit | |
Rat, Human, Mouse | |
O75901 | |
9182 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:YELLAKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHSQDSETTVGDVVLLST | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PAM COOH-terminal interactor protein 1, PAMCI, PCIP1, P-CIP1peptidylglycine alpha-amidating monooxygenase COOH-terminal interactorprotein-1, Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor, Ras association (RalGDS/AF-6) domain family (N-terminal) member 9, ras association domain-containing protein 9 | |
RASSF9 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title