Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pancreatic Lipase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Pancreatic Lipase |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Pancreatic Lipase Polyclonal specifically detects Pancreatic Lipase in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Pancreatic Lipase | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
EC 3.1.1.21, EC 3.1.1.3, pancreatic lipasepancreatic triacylglycerol lipase, PL, PTL, triacylglycerol acylhydrolase | |
PNLIP | |
IgG | |
Affinity Purified |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Rabbit | |
Human | |
P16233 | |
5406 | |
This antibody was developed against a recombinant protein corresponding to amino acids: PTLPRVGASKIIVETNVGKQFNFCSPETVR | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title