Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PANK4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PANK4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PANK4 Polyclonal specifically detects PANK4 in Human samples. It is validated for Western Blot.Specifications
PANK4 | |
Polyclonal | |
Rabbit | |
Q9NVE7 | |
55229 | |
Synthetic peptides corresponding to PANK4(pantothenate kinase 4) The peptide sequence was selected from the middle region of PANK4. Peptide sequence LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp547M242, EC 2.7.1.33, FLJ10782, hPanK4, pantothenate kinase 4, Pantothenic acid kinase 4 | |
PANK4 | |
IgG | |
86 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title