Pannexin-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159672

Catalog No. NBP159672

Description

Pannexin-1 Polyclonal specifically detects Pannexin-1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockout Validated.

Specifications

• Antigen: Pannexin-1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Guinea pig 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Knockout Validated
• Gene Accession No.: Q96RD7
• Gene Symbols: PANX1
• Immunogen: Synthetic peptides corresponding to PANX1(pannexin 1) The peptide sequence was selected from the middle region of PANX1. Peptide sequence LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 24145
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only