Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAOX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PAOX |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PAOX Polyclonal specifically detects PAOX in Human samples. It is validated for Western Blot.Specifications
PAOX | |
Polyclonal | |
Rabbit | |
Human | |
DKFZp434J245, MGC45464, PAO, polyamine oxidase, polyamine oxidase (exo-N4-amino) | |
PAOX | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q6QHF9 | |
196743 | |
Synthetic peptides corresponding to PAOX(polyamine oxidase (exo-N4-amino)) The peptide sequence was selected from the middle region of PAOX. Peptide sequence RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title