Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAPOLB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PAPOLB |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PAPOLB Polyclonal specifically detects PAPOLB in Human samples. It is validated for Western Blot.Specifications
| PAPOLB | |
| Polyclonal | |
| Rabbit | |
| A4D1Z6 | |
| 56903 | |
| Synthetic peptides corresponding to PAPOLB(poly(A) polymerase beta (testis specific)) The peptide sequence was selected from the middle region of PAPOLB. Peptide sequence MEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.7.7, EC 2.7.7.19, PAP-beta, PAPTTPAP, poly(A) polymerase beta, poly(A) polymerase beta (testis specific), Polynucleotide adenylyltransferase beta, Testis-specific poly(A) polymerase | |
| PAPOLB | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title