Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAPOLB Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PAPOLB |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157560
|
Novus Biologicals
NBP157560 |
100 μL |
Each for $436.00
|
|
NBP15756020
|
Novus Biologicals
NBP15756020UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
PAPOLB Polyclonal specifically detects PAPOLB in Human samples. It is validated for Western Blot.Specifications
| PAPOLB | |
| Polyclonal | |
| Rabbit | |
| A4D1Z6 | |
| 56903 | |
| Synthetic peptides corresponding to PAPOLB(poly(A) polymerase beta (testis specific)) The peptide sequence was selected from the N terminal of PAPOLB. Peptide sequence TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.7.7, EC 2.7.7.19, PAP-beta, PAPTTPAP, poly(A) polymerase beta, poly(A) polymerase beta (testis specific), Polynucleotide adenylyltransferase beta, Testis-specific poly(A) polymerase | |
| PAPOLB | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title