Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAPOLB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | PAPOLB |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PAPOLB Polyclonal specifically detects PAPOLB in Human samples. It is validated for Western Blot.Specifications
PAPOLB | |
Polyclonal | |
Rabbit | |
A4D1Z6 | |
56903 | |
Synthetic peptides corresponding to PAPOLB(poly(A) polymerase beta (testis specific)) The peptide sequence was selected from the N terminal of PAPOLB. Peptide sequence TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 2.7.7, EC 2.7.7.19, PAP-beta, PAPTTPAP, poly(A) polymerase beta, poly(A) polymerase beta (testis specific), Polynucleotide adenylyltransferase beta, Testis-specific poly(A) polymerase | |
PAPOLB | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title