Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pappalysin-2/PAPP-A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | Pappalysin-2/PAPP-A2 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Pappalysin-2/PAPP-A2 Polyclonal specifically detects Pappalysin-2/PAPP-A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Pappalysin-2/PAPP-A2 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
60676 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GDSSEDGHYFRGHLGTLVFWSTALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVLQGFE | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Human | |
EC 3.4.24.-, PAPP-A2pappalysin-2, pappalysin 2, PAPPE, PAPP-E, PLAC3, placenta-specific 3, pregnancy-associated plasma preproprotein-A2, Pregnancy-associated plasma protein A2, Pregnancy-associated plasma protein E1 | |
PAPPA2 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title