Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAQR6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PAQR6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PAQR6 Polyclonal specifically detects PAQR6 in Human samples. It is validated for Western Blot.Specifications
PAQR6 | |
Polyclonal | |
Rabbit | |
Q5TCK9 | |
79957 | |
Synthetic peptides corresponding to PAQR6(progestin and adipoQ receptor family member VI) The peptide sequence was selected from the N terminal of PAQR6. Peptide sequence PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
progestin and adipoQ receptor family member 6, progestin and adipoQ receptor family member VIFLJ22672 | |
PAQR6 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title