Invitrogen™ PAR1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA594929

Catalog No. PIPA594929

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: MCF-7 whole cell, HELA whole cell, 22RV1 whole cell, SW620 whole cell. IHC: Human Placenta Tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Thrombin is a serine protease that is involved in platelet aggregation and blood coagulation. It is cleaved from its precursor, prothrombin, and converts fibrinogen to fibrin in the final step of the clotting cascade. Thrombin mediates its regulatory effects by activating cell surface G-protein coupled receptors which include PAR-1, PAR-2 and PAR3.

Specifications

• Antigen: PAR1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: F2R
• Gene Alias: AI482343; C HTR; Cf2r; coagulation factor II (thrombin) receptor; coagulation factor II receptor; coagulation factor II thrombin receptor; F2R; HTR; PAR1; PAR-1; protease activated receptor 1; protease-activated receptor 1; proteinase-activated receptor 1; Thrombin receptor; ThrR; TR; TRGPC
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2149
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P25116
• Gene Symbols: F2R
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor (46-82aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG