Invitrogen™ PAR1 Polyclonal Antibody

Catalog No.	Quantity
PIPA594929	100 μg

Catalog No. PIPA594929 Supplier Invitrogen™ Supplier No. PA594929

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: MCF-7 whole cell, HELA whole cell, 22RV1 whole cell, SW620 whole cell. IHC: Human Placenta Tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Thrombin is a serine protease that is involved in platelet aggregation and blood coagulation. It is cleaved from its precursor, prothrombin, and converts fibrinogen to fibrin in the final step of the clotting cascade. Thrombin mediates its regulatory effects by activating cell surface G-protein coupled receptors which include PAR-1, PAR-2 and PAR3.

Specifications

• Antigen: PAR1
• Applications: Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene: F2R
• Gene Accession No.: P25116
• Gene Alias: AI482343; C HTR; Cf2r; coagulation factor II (thrombin) receptor; coagulation factor II receptor; coagulation factor II thrombin receptor; F2R; HTR; PAR1; PAR-1; protease activated receptor 1; protease-activated receptor 1; proteinase-activated receptor 1; Thrombin receptor; ThrR; TR; TRGPC
• Gene Symbols: F2R
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor (46-82aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2149
• Target Species: Human
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG