Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PARD6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23848725UL
Description
PARD6A Polyclonal specifically detects PARD6A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
PARD6A | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q9NPB6 | |
PARD6A | |
This antibody was developed against a recombinant protein corresponding to amino acids: DLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFS | |
25 μL | |
Cell Cycle and Replication | |
50855 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PAR-6, PAR-6 alpha, par-6 partitioning defective 6 homolog alpha (C. elegans), PAR6A, PAR6alpha, PAR-6Apar-6 (partitioning defective 6, C.elegans) homolog alpha, PAR6C, partitioning defective 6 homolog alpha, partitioning defective-6 homolog alpha, partitioning-defective protein 6, Tax interaction protein 40, TAX40, Tax-interacting protein 40, TIP-40PAR6 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction