Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PARN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | PARN |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
PARN Polyclonal specifically detects PARN in Human, Mouse samples. It is validated for Western Blot.Specifications
| PARN | |
| Polyclonal | |
| Purified | |
| RUO | |
| DANEC 3.1.13.4, Deadenylating nuclease, Deadenylation nuclease, poly(A)-specific ribonuclease (deadenylation nuclease), poly(A)-specific ribonuclease PARN, Polyadenylate-specific ribonuclease | |
| PARN | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_083037 | |
| 5073 | |
| Synthetic peptide directed towards the N terminal of human PARN. Peptide sequence IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ. | |
| Primary | |
| 69 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title