Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PARP10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25705625UL
Description
PARP10 Polyclonal specifically detects PARP10 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PARP10 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
EC 2.4.2.30, FLJ14464, PARP-10, poly (ADP-ribose) polymerase family, member 10, poly [ADP-ribose] polymerase 10 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PARP10 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCG | |
25 μL | |
Apoptosis, DNA Repair, Hypoxia | |
84875 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction