Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579784

Invitrogen™ PARVA Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579784
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579784 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579784 Supplier Invitrogen™ Supplier No. PA579784
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Liver Tissue, HELA whole cell, SW620 whole cell, HEPA whole cell. IHC: human mammary cancer tissue.

The protein encoded by this gene is a transcription factor that contains C2H2-type zinc-fingers. It also contains a positive regulatory domain, which has been found in several other zinc-finger transcription factors including those involved in B cell differentiation and tumor suppression. Studies of the mouse counterpart suggest that this protein may be involved in the development of the central nerve system (CNS), as well as in the pathogenesis of neuronal storage disease. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PARVA
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene PARVA
Gene Accession No. Q9EPC1, Q9HB97, Q9NVD7
Gene Alias 2010012A22Rik; 5430400F08Rik; Actopaxin; Actp; AI225929; Alpha-parvin; alpha-parvin-like; AU042898; Calponin-like integrin-linked kinase-binding protein; CH-ILKBP; FLJ10793; FLJ12254; I79_014720; Matrix-remodeling-associated protein 2; MNCb-0301; MXRA2; PARVA; Parvin; parvin alpha; parvin, alpha
Gene Symbols PARVA
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155-185aa QKLQTVLEKINETLKLPPRSIKWNVDSVHAK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55742, 57341, 57342
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.