Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PARVB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | PARVB |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1592920
|
Novus Biologicals
NBP15912920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159129
|
Novus Biologicals
NBP159129 |
100 μL |
Each for $499.50
|
|
|||||
Description
PARVB Polyclonal specifically detects PARVB in Human samples. It is validated for Western Blot.Specifications
| PARVB | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| affixin, beta-parvin, CGI-56, parvin, beta | |
| PARVB | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96PN1 | |
| 29780 | |
| Synthetic peptides corresponding to PARVB(parvin, beta) The peptide sequence was selected from the N terminal of PARVB. Peptide sequence LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title