Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Patched 1/PTCH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Patched 1/PTCH |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Patched 1/PTCH Polyclonal specifically detects Patched 1/PTCH in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Patched 1/PTCH | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, Stem Cell Signaling Pathway | |
BCNSFLJ42602, FLJ26746, HPE7, NBCCS, patched (Drosophila) homolog, patched 1, patched homolog (Drosophila), patched homolog 1, patched homolog 1 (Drosophila), protein patched homolog 1, PTC, PTC1, PTCH, PTCH protein +12b, PTCH protein +4', PTCH protein -10, PTCH11 | |
PTCH1 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
5727 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title