Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Patched 1/PTCH Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Manufacturer:  Novus Biologicals™ NBP257927PEP

Catalog No. NBP257927PE

Add to cart



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Patched 1/PTCH. Source: E.coli Amino Acid Sequence: SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS The Patched 1/PTCH Recombinant Protein Antigen is derived from E. coli. The Patched 1/PTCH Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.


Blocking/Neutralizing, Control
>80% by SDS-PAGE and Coomassie blue staining
PBS and 1M Urea, pH 7.4
Patched 1/PTCH Recombinant Protein Antigen
Store at −20°C. Avoid freeze-thaw cycles
BCNSFLJ42602, FLJ26746, HPE7, NBCCS, patched (Drosophila) homolog, patched 1, patched homolog (Drosophila), patched homolog 1, patched homolog 1 (Drosophila), protein patched homolog 1, PTC, PTC1, PTCH, PTCH protein +12b, PTCH protein +4', PTCH protein -1
Recombinant Protein Antigen
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For research use only.