PAUF/ZG16B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP181699

Catalog No. NBP181699

Description

PAUF/ZG16B Polyclonal specifically detects PAUF/ZG16B in Human samples. It is validated for Western Blot, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PAUF/ZG16B
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Alias: DKFZp762P2216, EC 3.1.2, EC 3.4.19.12, hTrabid, TRABIDubiquitin thioesterase ZRANB1, TRAF-binding protein domain, Zinc finger Ran-binding domain-containing protein 1, zinc finger, RAN-binding domain containing 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 124220
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ZG16B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQA
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only