Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PBOV1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP325041
Description
PBOV1 Polyclonal antibody specifically detects PBOV1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
PBOV1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
prostate and breast cancer overexpressed 1, Protein UROC28, UC28UROC28dJ171N11.2 | |
This antibody has been engineered to specifically recognize the recombinant protein PBOV1 using the following amino acid sequence: YSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFT | |
100 μL | |
Primary | |
Human | |
Purified |
Immunocytochemistry | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
59351 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction