PC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157908

Catalog No. NBP157908

Description

PC6 Polyclonal specifically detects PC6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PC6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.21, EC 3.4.21.-, EC 3.4.21.61, EC 3.4.21.75, FLJ11149, FLJ16215, hPC6, PC5PC6A, PC6prohormone convertase 5, Proprotein convertase 5, Proprotein convertase 6, proprotein convertase PC5, proprotein convertase subtilisin/kexin type 5, protease PC6, SPC6, Subtilisin/kexin-like protease PC5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5125
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q92824
• Gene Symbols: PCSK5
• Immunogen: Synthetic peptides corresponding to PCSK5(proprotein convertase subtilisin/kexin type 5) The peptide sequence was selected from the middle region of PCSK5. Peptide sequence CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

For Research Use Only