Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCDHA5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PCDHA5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PCDHA5 Polyclonal specifically detects PCDHA5 in Human samples. It is validated for Western Blot.Specifications
PCDHA5 | |
Polyclonal | |
Rabbit | |
Q9Y5H7 | |
56143 | |
Synthetic peptides corresponding to PCDHA5(protocadherin alpha 5) The peptide sequence was selected from the N terminal of PCDHA5. Peptide sequence VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CNR6, CNRN6, CNRS6, CRNR6, KIAA0345-like 9, ortholog of mouse CNR6, PCDH-alpha-5, PCDH-ALPHA5, protocadherin alpha 5, protocadherin alpha-5 | |
PCDHA5 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title