Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCDHAC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PCDHAC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PCDHAC1 Polyclonal specifically detects PCDHAC1 in Human samples. It is validated for Western Blot.Specifications
PCDHAC1 | |
Polyclonal | |
Rabbit | |
B2RNA7 | |
56135 | |
Synthetic peptides corresponding to PCDHAC1(protocadherin alpha subfamily C, 1) The peptide sequence was selected from the N terminal of PCDHAC1. Peptide sequence RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
PCDH-ALPHA-C1, protocadherin alpha subfamily C, 1, protocadherin alpha-C1 | |
PCDHAC1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title