Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCDHGA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PCDHGA4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PCDHGA4 Polyclonal specifically detects PCDHGA4 in Human samples. It is validated for Western Blot.Specifications
PCDHGA4 | |
Polyclonal | |
Rabbit | |
Q9Y5G9-2 | |
56111 | |
Synthetic peptides corresponding to PCDHGA4(protocadherin gamma subfamily A, 4) The peptide sequence was selected from the N terminal of PCDHGA4. Peptide sequence GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
PCDH-GAMMA-A4, protocadherin gamma subfamily A, 4, protocadherin gamma-A4 | |
PCDHGA4 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title