Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCGF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PCGF1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PCGF1 Polyclonal specifically detects PCGF1 in Human samples. It is validated for Western Blot.Specifications
PCGF1 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
MGC10882, Nervous system Polycomb-1, NSPc1, NSPC1FLJ43754, polycomb group ring finger 1,2010002K04Rik, polycomb group RING finger protein 1, RING finger protein 68, RNF68RNF3A-2 | |
PCGF1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9BSM1 | |
84759 | |
Synthetic peptides corresponding to PCGF1 (polycomb group ring finger 1) The peptide sequence was selected from the middle region of PCGF1. Peptide sequence PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title