Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PCMTD1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP154370 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154370 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154370 Supplier Novus Biologicals Supplier No. NBP154370
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PCMTD1 Polyclonal specifically detects PCMTD1 in Human samples. It is validated for Western Blot.

Specifications

Antigen PCMTD1
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96MG8
Gene Alias FLJ10883, protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1, protein-L-isoaspartate O-methyltransferase domain-containing protein 1
Gene Symbols PCMTD1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PCMTD1(protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1) The peptide sequence was selected from the middle region of PCMTD1. Peptide sequence TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 41 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 115294
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.