Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCNP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PCNP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PCNP Polyclonal specifically detects PCNP in Mouse samples. It is validated for Western Blot.Specifications
PCNP | |
Polyclonal | |
Rabbit | |
NP_001019793 | |
57092 | |
Synthetic peptide directed towards the C terminal of human PcnpThe immunogen for this antibody is Pcnp. Peptide sequence AFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp781I24156, PEST proteolytic signal containing nuclear protein, PEST proteolytic signal-containing nuclear protein, PEST-containing nuclear protein | |
PCNP | |
IgG | |
20 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title