PCP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 5 publications

Supplier:  Novus Biologicals NBP180929

Catalog No. NBP180929

Description

PCP4 Polyclonal specifically detects PCP4 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PCP4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: brain specific polypeptide PEP19, 10Brain-specific antigen PCP-4, Brain-specific polypeptide PEP-19, PEP19, PEP-19, Purkinje cell protein 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5121
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.05mg/mL
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P48539
• Gene Symbols: PCP4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human PCP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only