PDE11A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP185919

Catalog No. NBP185919

Description

PDE11A Polyclonal specifically detects PDE11A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PDE11A
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: cAMP and cGMP cyclic nucleotide phosphodiesterase 11A, cAMP and cGMP phosphodiesterase 11A, cyclic nucleotide phosphodiesterase 11A, dual 3'-5'-cyclic-AMP and -GMP phosphodiesterase 11A, EC 3.1.4, EC 3.1.4.17, EC 3.1.4.35, FLJ23693, MGC133355, MGC133356, PDE11A1, PDE11A2, PDE11A3, phosphodiesterase 11A, PPNAD2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PDE11A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 50940
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only