Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDE6 beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PDE6 beta |
---|---|
Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PDE6 beta Polyclonal specifically detects PDE6 beta in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
PDE6 beta | |
Polyclonal | |
Rabbit | |
Human | |
CSNB3, EC 3.1.4, EC 3.1.4.35, GMP-PDE beta, PDEBrod cGMP-phosphodiesterase beta-subunit, phosphodiesterase 6B, cGMP-specific, rod, beta, rd1, rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit beta, RP40CSNBAD2 | |
PDE6B | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5158 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEEST | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title