PDE7B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152979

Catalog No. NBP152979

Description

PDE7B Polyclonal specifically detects PDE7B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PDE7B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bA472E5.1, cAMP-specific 3'-5'-cyclic phosphodiesterase 7B, EC 3.1.4, EC 3.1.4.17, high-affinity cAMP-specific 3'-5'-cyclic phosphodiesterase, MGC88256, phosphodiesterase 7B, rolipram-insensitive phosphodiesterase type 7
• Host Species: Rabbit
• Molecular Weight of Antigen: 52 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction, Vision
• Gene ID (Entrez): 27115
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NP56
• Gene Symbols: PDE7B
• Immunogen: Synthetic peptides corresponding to PDE7B(phosphodiesterase 7B) The peptide sequence was selected from the middle region of PDE7B. Peptide sequence IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected to cross react based on sequence identity: Zebrafish: 75%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only