PDHA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179536

Catalog No. NBP179536

Description

PDHA2 Polyclonal specifically detects PDHA2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PDHA2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 1.2.4.1, MGC149517, MGC149518, mitochondrial, PDHAL, PDHE1-A type II, pyruvate dehydrogenase (lipoamide) alpha 2, pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, pyruvate dehydrogenase, E1-alpha polypeptide, testis specific
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 86%; Horse: 85%; Dog: 79%; Pig: 79%; Zebrafish: 79%; Guinea pig: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_005381
• Gene Symbols: PDHA2
• Immunogen: Synthetic peptide directed towards the N terminal of human PDHA2The immunogen for this antibody is PDHA2. Peptide sequence RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5161
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.