Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDHA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PDHA2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PDHA2 Polyclonal specifically detects PDHA2 in Human samples. It is validated for Western Blot.Specifications
PDHA2 | |
Polyclonal | |
Rabbit | |
NP_005381 | |
5161 | |
Synthetic peptide directed towards the N terminal of human PDHA2The immunogen for this antibody is PDHA2. Peptide sequence RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 1.2.4.1, MGC149517, MGC149518, mitochondrial, PDHAL, PDHE1-A type II, pyruvate dehydrogenase (lipoamide) alpha 2, pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, pyruvate dehydrogenase, E1-alpha polypeptide, testis specific | |
PDHA2 | |
IgG | |
43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title