Invitrogen™ PDPK1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579801

Catalog No. PIPA579801

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Liver Tissue, Rat Lung Tissue, Mouse Liver Tissue, Mouse Lung Tissue, COLO320 whole cell, MCF-7 whole cell. IHC: Mouse Intestine tissue, Rat Testis tissue, Human Lung Cancer tissue IHC-F: human placenta tissue, mouse small intestine tissue.

PDPK1 (3 Phosphoinositide Dependent Protein Kinase 1) phosphorylates AGC kinases. PDPK1 activates conventional PKC and PKC zeta through phosphorylation of critical threonine residues in the activation loop. PDPK1 also phosphorylates Protein Kinase B (PKB) at threonine 308 in the presence of phosphatidylinositol-3,4,5-trisphosphate. Active Akt inactivates Glycogen Synthase Kinase 3 (GSK3), eventually leading to the dephosphorylation and activation of glycogen synthase, and the stimulation of glycogen synthesis. Because of the role that PDPK1 plays in insulin-induced glycogen synthesis and PKC activation, it is a potentially important target for metabolic drug research.

Specifications

• Antigen: PDPK1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Pdpk1
• Gene Alias: 3-phosphoinositide dependent protein kinase 1; 3-phosphoinositide dependent protein kinase-1; 3-phosphoinositide-dependent protein kinase 1; 3-phosphoinositide-dependent protein kinase 2 pseudogene; HGNC:8809; hPDK1; isoenzyme 1; kinase isoenzyme 1; lipoamide; mPDK1; OTTHUMP00000174525; OTTHUMP00000205076; PDK1; PDPK1; PDPK2; PDPK2P; Pkb kinase; PkB kinase like gene 1; PkB-like 1; PRO0461; Protein kinase B kinase
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 18607, 5170, 81745
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O15530, O55173, Q9Z2A0
• Gene Symbols: Pdpk1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov